Solution-state structures of oleate-liganded lfabp, major form of 1:2 protein-ligand complex
PDB DOI: 10.2210/pdb2ju8/pdb
Classification: LIPID BINDING PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2007-08-15 Deposition Author(s): Estephan, R. , Francis, F. , He, Y. , Kodukula, S. , Stark, R.E. , Storch, J. , Wang, H. , Yang, X.
Solution-state structures of oleate-liganded lfabp, major form of 1:2 protein-ligand complex
Estephan, R. , Francis, F. , He, Y. , Kodukula, S. , Stark, R.E. , Storch, J. , Wang, H. , Yang, X.
Primary Citation of Related Structures: 2JU8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fatty acid-binding protein, liver | A | 127 | Rattus Norvegicus | MNFSGKYQVQSQENFEPFMKAMGLPEDLIQKGKDIKGVSEIVHEGKKVKLTITYGSKVIHNEFTLGEECELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNGDTITNTMTLGDIVYKRVSKRI |
Method: SOLUTION NMR
Deposited Date: 2007-08-15 Deposition Author(s): Estephan, R. , Francis, F. , He, Y. , Kodukula, S. , Stark, R.E. , Storch, J. , Wang, H. , Yang, X.