Yellow fever envelope protein domain iii nmr structure (s288-k398)
PDB DOI: 10.2210/pdb2jqm/pdb
Classification: TRANSFERASE Organism(s): Yellow Fever Virus
Deposited: 2007-06-03 Deposition Author(s): Anderson, A. , Barrett, A.D. , Gandham, S.H. , Gorenstein, D.G. , May, F.J. , Volk, D.E.
Yellow fever envelope protein domain iii nmr structure (s288-k398)
Anderson, A. , Barrett, A.D. , Gandham, S.H. , Gorenstein, D.G. , May, F.J. , Volk, D.E.
Primary Citation of Related Structures: 2JQM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Envelope protein E | A | 112 | Yellow Fever Virus | MSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADDLTAAINKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIGK |
Method: SOLUTION NMR
Deposited Date: 2007-06-03 Deposition Author(s): Anderson, A. , Barrett, A.D. , Gandham, S.H. , Gorenstein, D.G. , May, F.J. , Volk, D.E.