Solution structure of the bisphosphorylated cardiac specific n-extension of cardiac troponin i
PDB DOI: 10.2210/pdb2jpw/pdb
Classification: CONTRACTILE PROTEIN Organism(s): N.A.
Deposited: 2007-05-24 Deposition Author(s): Howarth, J.W. , Meller, J. , Rosevear, P.R. , Solaro, R.J. , Trewhella, J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the bisphosphorylated cardiac specific n-extension of cardiac troponin i
Howarth, J.W. , Meller, J. , Rosevear, P.R. , Solaro, R.J. , Trewhella, J.
Primary Citation of Related Structures: 2JPW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Troponin I, cardiac muscle | A | 32 | N.A. | MADESSDAAGEPQPAPAPVRRRSSANYRAYAT |
Method: SOLUTION NMR
Deposited Date: 2007-05-24 Deposition Author(s): Howarth, J.W. , Meller, J. , Rosevear, P.R. , Solaro, R.J. , Trewhella, J.