Structural basis of rsma/csra rna recognition: structure of rsme bound to the shine-dalgarno sequence of hcna mrna
PDB DOI: 10.2210/pdb2jpp/pdb
Classification: TRANSLATION/RNA Organism(s): Pseudomonas Fluorescens , Synthetic Construct
Deposited: 2007-05-21 Deposition Author(s): Allain, F.H.-T. , Duss, O. , Haas, D. , Jelesarov, I. , Lapouge, K. , Oberstrass, F.C. , Schubert, M.
Structural basis of rsma/csra rna recognition: structure of rsme bound to the shine-dalgarno sequence of hcna mrna
Allain, F.H.-T. , Duss, O. , Haas, D. , Jelesarov, I. , Lapouge, K. , Oberstrass, F.C. , Schubert, M.
Primary Citation of Related Structures: 2JPP
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Translational repressor | A | 70 | Pseudomonas Fluorescens , Synthetic Construct | MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH |
Translational repressor | B | 70 | Pseudomonas Fluorescens , Synthetic Construct | MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2007-05-21 Deposition Author(s): Allain, F.H.-T. , Duss, O. , Haas, D. , Jelesarov, I. , Lapouge, K. , Oberstrass, F.C. , Schubert, M.