Structure of the wilms tumor suppressor protein zinc finger domain bound to dna
PDB DOI: 10.2210/pdb2jpa/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2007-05-01 Deposition Author(s): Debler, E.W. , Dyson, H.J. , Laity, J.H. , Lee, B.M. , Stoll, R. , Wilson, I.A. , Wright, P.E.
Method: SOLUTION NMR Resolution: N.A.
Structure of the wilms tumor suppressor protein zinc finger domain bound to dna
Debler, E.W. , Dyson, H.J. , Laity, J.H. , Lee, B.M. , Stoll, R. , Wilson, I.A. , Wright, P.E.
Primary Citation of Related Structures: 2JPA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Wilms tumor 1 | A | 119 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH |
Method: SOLUTION NMR
Deposited Date: 2007-05-01 Deposition Author(s): Debler, E.W. , Dyson, H.J. , Laity, J.H. , Lee, B.M. , Stoll, R. , Wilson, I.A. , Wright, P.E.