Solution structure and resonance assignment of the n-terminal evh1 domain from the human spred2 protein (sprouty-related protein with evh1 domain isoform 2)
PDB DOI: 10.2210/pdb2jp2/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-04-18 Deposition Author(s): Arrowsmith, C. , Ball, L.J. , Edwards, A. , Fossi, M. , Jarchau, T. , Lemak, A. , Oschkinat, H. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Walter, U. , Wiegelt, J. , Zimmermann, J.
Solution structure and resonance assignment of the n-terminal evh1 domain from the human spred2 protein (sprouty-related protein with evh1 domain isoform 2)
Arrowsmith, C. , Ball, L.J. , Edwards, A. , Fossi, M. , Jarchau, T. , Lemak, A. , Oschkinat, H. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Walter, U. , Wiegelt, J. , Zimmermann, J.
Primary Citation of Related Structures: 2JP2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sprouty-related, EVH1 domain-containing protein 2 | A | 126 | Homo Sapiens | GSMTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIHGERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIEDLIE |
Method: SOLUTION NMR
Deposited Date: 2007-04-18 Deposition Author(s): Arrowsmith, C. , Ball, L.J. , Edwards, A. , Fossi, M. , Jarchau, T. , Lemak, A. , Oschkinat, H. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Walter, U. , Wiegelt, J. , Zimmermann, J.