2JO9
Mouse itch 3rd ww domain complex with the epstein-barr virus latent membrane protein 2a derived peptide eeppppyed
PDB DOI: 10.2210/pdb2jo9/pdb
Classification: LIGASE Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2007-03-01 Deposition Author(s): Macias, M.J. , Martin-Malpartida, P. , Morales, B. , Ramirez-Espain, X. , Royo, M. , Ruiz, L. , Shaw, A.Z. , Yraola, F.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Mouse itch 3rd ww domain complex with the epstein-barr virus latent membrane protein 2a derived peptide eeppppyed
Macias, M.J. , Martin-Malpartida, P. , Morales, B. , Ramirez-Espain, X. , Royo, M. , Ruiz, L. , Shaw, A.Z. , Yraola, F.
Primary Citation of Related Structures: 2JO9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Itchy E3 ubiquitin protein ligase | A | 37 | Mus Musculus , Synthetic Construct | GAMGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRS |
| Latent membrane protein 2 | B | 9 | Mus Musculus , Synthetic Construct | EEPPPPYED |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-03-01 Deposition Author(s): Macias, M.J. , Martin-Malpartida, P. , Morales, B. , Ramirez-Espain, X. , Royo, M. , Ruiz, L. , Shaw, A.Z. , Yraola, F.