Solution structure of scytovirin refined against residual dipolar couplings
PDB DOI: 10.2210/pdb2jmv/pdb
Classification: ANTIVIRAL PROTEIN Organism(s): Scytonema Varium
Deposited: 2006-12-07 Deposition Author(s): Byrd, R.A. , Mcfeeters, R.L.
Solution structure of scytovirin refined against residual dipolar couplings
Primary Citation of Related Structures: 2JMV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Scytovirin | A | 95 | Scytonema Varium | GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA |
Method: SOLUTION NMR
Deposited Date: 2006-12-07 Deposition Author(s): Byrd, R.A. , Mcfeeters, R.L.