Solution structure of the rgs domain from human rgs18
PDB DOI: 10.2210/pdb2jm5/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2006-10-11 Deposition Author(s): Arrowsmith, C. , Ball, L.J. , Bray, J. , Brockmann, C. , Diehl, A. , Doyle, D.A. , Edwards, A. , Elkins, J. , Gileadi, C. , Higman, V.A. , Leidert, M. , Oschkinat, H. , Phillips, C. , Schmieder, P. , Schoch, G. , Soundararajan, M. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Weigelt, J. , Yang, X.
Solution structure of the rgs domain from human rgs18
Arrowsmith, C. , Ball, L.J. , Bray, J. , Brockmann, C. , Diehl, A. , Doyle, D.A. , Edwards, A. , Elkins, J. , Gileadi, C. , Higman, V.A. , Leidert, M. , Oschkinat, H. , Phillips, C. , Schmieder, P. , Schoch, G. , Soundararajan, M. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Weigelt, J. , Yang, X.
Primary Citation of Related Structures: 2JM5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Regulator of G-protein signaling 18 | A | 151 | Homo Sapiens | SMVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNE |
Method: SOLUTION NMR
Deposited Date: 2006-10-11 Deposition Author(s): Arrowsmith, C. , Ball, L.J. , Bray, J. , Brockmann, C. , Diehl, A. , Doyle, D.A. , Edwards, A. , Elkins, J. , Gileadi, C. , Higman, V.A. , Leidert, M. , Oschkinat, H. , Phillips, C. , Schmieder, P. , Schoch, G. , Soundararajan, M. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Weigelt, J. , Yang, X.