2JF1
Crystal structure of the filamin a repeat 21 complexed with the integrin beta2 cytoplasmic tail peptide
PDB DOI: 10.2210/pdb2jf1/pdb
Classification: CELL ADHESION Organism(s): Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2007-01-25 Deposition Author(s): Kiema, T. , Ylanne, J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.2 Å
Crystal structure of the filamin a repeat 21 complexed with the integrin beta2 cytoplasmic tail peptide
Primary Citation of Related Structures: 2JF1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| FILAMIN-A | A | 97 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS |
| INTEGRIN BETA-2 SUBUNIT | T | 35 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | YRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2007-01-25 Deposition Author(s): Kiema, T. , Ylanne, J.