N-terminal sh3 domain of cms (cd2ap human homolog) bound to cbl-b peptide
PDB DOI: 10.2210/pdb2j6f/pdb
Classification: PROTEIN BINDING Organism(s): Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-09-28 Deposition Author(s): Bravo, J. , Cardenes, N. , Deribe, Y.L. , Dikic, I. , Moncalian, G. , Spinola-Amilibia, M.
N-terminal sh3 domain of cms (cd2ap human homolog) bound to cbl-b peptide
Bravo, J. , Cardenes, N. , Deribe, Y.L. , Dikic, I. , Moncalian, G. , Spinola-Amilibia, M.
Primary Citation of Related Structures: 2J6F
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
CD2-ASSOCIATED PROTEIN | A | 62 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETE |
E3 UBIQUITIN-PROTEIN LIGASE CBL-B | C | 11 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PARPPKPRPRR |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-09-28 Deposition Author(s): Bravo, J. , Cardenes, N. , Deribe, Y.L. , Dikic, I. , Moncalian, G. , Spinola-Amilibia, M.