Dark state structure of the bluf domain of the rhodobacterial protein appa
PDB DOI: 10.2210/pdb2iyg/pdb
Classification: SIGNAL TRANSDUCTION Organism(s): Rhodobacter Sphaeroides
Deposited: 2006-07-17 Deposition Author(s): Domratcheva, T. , Jung, A. , Reinstein, J. , Schlichting, I. , Shoeman, R.-L.
Dark state structure of the bluf domain of the rhodobacterial protein appa
Domratcheva, T. , Jung, A. , Reinstein, J. , Schlichting, I. , Shoeman, R.-L.
Primary Citation of Related Structures: 2IYG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| APPA, ANTIREPRESSOR OF PPSR, SENSOR OF BLUE LIGHT | A | 124 | Rhodobacter Sphaeroides | MQHDLEADVTMTGSDLVSCSYRSLAAPDLTLRDLLDIVETSQAHNARAQLTGALFYSQGVFFQWLEGRPAAVAEVMTHIQRDRRHSNVEILAEEPIAKRRFAGWHMQLSCSEADMRSLGLAESR |
| APPA, ANTIREPRESSOR OF PPSR, SENSOR OF BLUE LIGHT | B | 124 | Rhodobacter Sphaeroides | MQHDLEADVTMTGSDLVSCSYRSLAAPDLTLRDLLDIVETSQAHNARAQLTGALFYSQGVFFQWLEGRPAAVAEVMTHIQRDRRHSNVEILAEEPIAKRRFAGWHMQLSCSEADMRSLGLAESR |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-07-17 Deposition Author(s): Domratcheva, T. , Jung, A. , Reinstein, J. , Schlichting, I. , Shoeman, R.-L.