Crystal structure of the pi3-kinase p85 n-terminal sh2 domain in complex with pdgfr phosphotyrosyl peptide
PDB DOI: 10.2210/pdb2iui/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-06-03 Deposition Author(s): Eck, M.J. , Harrison, S.C. , Nolte, R.T. , Schlessinger, J. , Shoelson, S.E.
Crystal structure of the pi3-kinase p85 n-terminal sh2 domain in complex with pdgfr phosphotyrosyl peptide
Eck, M.J. , Harrison, S.C. , Nolte, R.T. , Schlessinger, J. , Shoelson, S.E.
Primary Citation of Related Structures: 2IUI
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Phosphatidylinositol 3-kinase regulatory subunit alpha | A | 120 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GMNNNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKED |
Phosphatidylinositol 3-kinase regulatory subunit alpha | B | 120 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GMNNNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKED |
Platelet-derived growth factor receptor beta | C | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SIDYVPMLDMK |
Platelet-derived growth factor receptor beta | D | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SIDYVPMLDMK |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-03 Deposition Author(s): Eck, M.J. , Harrison, S.C. , Nolte, R.T. , Schlessinger, J. , Shoelson, S.E.