Crystal structure of the n-terminal domain of htpg, the escherichia coli hsp90, bound to adp
PDB DOI: 10.2210/pdb2ior/pdb
Classification: CHAPERONE Organism(s): Escherichia Coli
Deposited: 2006-10-10 Deposition Author(s): Agard, D.A. , Harris, S.F. , Shiau, A.K.
Crystal structure of the n-terminal domain of htpg, the escherichia coli hsp90, bound to adp
Agard, D.A. , Harris, S.F. , Shiau, A.K.
Primary Citation of Related Structures: 2IOR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chaperone protein htpG | A | 235 | Escherichia Coli | MGSSHHHHHHSSGLVPRGSHMKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTKSFLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREE |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-10-10 Deposition Author(s): Agard, D.A. , Harris, S.F. , Shiau, A.K.