Solution structure of the first clip domain in pap2
PDB DOI: 10.2210/pdb2ikd/pdb
Classification: HYDROLASE Organism(s): Aspergillus Sydowii
Deposited: 2006-10-02 Deposition Author(s): Dai, H.E. , Huang, R.D. , Jiang, H.B. , Lv, Z.Q. , Prakash, O. , Velde, D.V.
Solution structure of the first clip domain in pap2
Dai, H.E. , Huang, R.D. , Jiang, H.B. , Lv, Z.Q. , Prakash, O. , Velde, D.V.
Primary Citation of Related Structures: 2IKD
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Prophenoloxidase activating proteinase-2 | A | 66 | Aspergillus Sydowii | MHHHHHHAMGQACTLPNNDKGTCKSLLQCDVASKIISKKPRTAQDEKFLRESACGFDGQTPKVCCP |
Method: SOLUTION NMR
Deposited Date: 2006-10-02 Deposition Author(s): Dai, H.E. , Huang, R.D. , Jiang, H.B. , Lv, Z.Q. , Prakash, O. , Velde, D.V.