2I5S
Crystal structure of onconase with bound nucleic acid
PDB DOI: 10.2210/pdb2i5s/pdb
Classification: HYDROLASE/DNA Organism(s): Paenibacillus Sp. Soil724D2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-08-25 Deposition Author(s): Bae, E. , Bingman, C.A. , Bitto, E. , Center For Eukaryotic Structural Genomics (Cesg) , Lee, J.E. , Phillips Jr., G.N. , Raines, R.T. , Wesenberg, G.E.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Crystal structure of onconase with bound nucleic acid
Bae, E. , Bingman, C.A. , Bitto, E. , Center For Eukaryotic Structural Genomics (Cesg) , Lee, J.E. , Phillips Jr., G.N. , Raines, R.T. , Wesenberg, G.E.
Primary Citation of Related Structures: 2I5S
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| P-30 protein | X | 104 | Paenibacillus Sp. Soil724D2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKLKKSTNKFCVTCENQAPVHFVGVGSC |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5'-D(*A*(DU)P*GP*A)-3' | a | 4 | NA | AUGA |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2006-08-25 Deposition Author(s): Bae, E. , Bingman, C.A. , Bitto, E. , Center For Eukaryotic Structural Genomics (Cesg) , Lee, J.E. , Phillips Jr., G.N. , Raines, R.T. , Wesenberg, G.E.