Structure of human fe65-ww domain in complex with hmena peptide.
PDB DOI: 10.2210/pdb2ho2/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2006-07-13 Deposition Author(s): Birrane, G. , Ladias, J.A. , Meiyappan, M.
Structure of human fe65-ww domain in complex with hmena peptide.
Birrane, G. , Ladias, J.A. , Meiyappan, M.
Primary Citation of Related Structures: 2HO2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Amyloid beta A4 protein-binding family B member 1 | A | 38 | Homo Sapiens , Synthetic Construct | GSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPS |
Protein enabled homolog | B | 10 | Homo Sapiens , Synthetic Construct | PPPPPPPPPL |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-07-13 Deposition Author(s): Birrane, G. , Ladias, J.A. , Meiyappan, M.