2HO2
Structure of human fe65-ww domain in complex with hmena peptide.
PDB DOI: 10.2210/pdb2ho2/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-07-13 Deposition Author(s): Birrane, G. , Ladias, J.A. , Meiyappan, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.33 Å
Structure of human fe65-ww domain in complex with hmena peptide.
Birrane, G. , Ladias, J.A. , Meiyappan, M.
Primary Citation of Related Structures: 2HO2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Amyloid beta A4 protein-binding family B member 1 | A | 38 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPS |
| Protein enabled homolog | B | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PPPPPPPPPL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2006-07-13 Deposition Author(s): Birrane, G. , Ladias, J.A. , Meiyappan, M.