Crystal structure of a 3d domain-swapped dimer of protein hi0395 from haemophilus influenzae
PDB DOI: 10.2210/pdb2hj1/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Haemophilus Influenzae
Deposited: 2006-06-29 Deposition Author(s): Almo, S.C. , Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Patskovsky, Y.V. , Ramagopal, U.A. , Toro, R.
Crystal structure of a 3d domain-swapped dimer of protein hi0395 from haemophilus influenzae
Almo, S.C. , Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Patskovsky, Y.V. , Ramagopal, U.A. , Toro, R.
Primary Citation of Related Structures: 2HJ1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hypothetical protein | A | 97 | Haemophilus Influenzae | MAHHHHHHSLNQINIEIAYAFPERYYLKSFQVDEGITVQTAITQSGILSQFPEIDLSTNKIGIFSRPIKLTDVLKEGDRIEIYRPLLADPKEIRREG |
| Hypothetical protein | B | 97 | Haemophilus Influenzae | MAHHHHHHSLNQINIEIAYAFPERYYLKSFQVDEGITVQTAITQSGILSQFPEIDLSTNKIGIFSRPIKLTDVLKEGDRIEIYRPLLADPKEIRREG |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-29 Deposition Author(s): Almo, S.C. , Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Patskovsky, Y.V. , Ramagopal, U.A. , Toro, R.