Solution nmr structure of phage-like element pbsx protein xkdw, northeast structural genomics consortium target sr355
PDB DOI: 10.2210/pdb2hg7/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Bacillus Subtilis
Deposited: 2006-06-26 Deposition Author(s): Acton, T.B. , Atreya, H. , Baran, M. , Cunningham, K. , Ho, C.K. , Jiang, M. , Liu, G. , Liu, J. , Ma, L.-C. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Parish, D. , Rost, B. , Sukumaran, D. , Swapna, G.V. , Szyperski, T. , Xiao, R. , Xu, D.
Solution nmr structure of phage-like element pbsx protein xkdw, northeast structural genomics consortium target sr355
Acton, T.B. , Atreya, H. , Baran, M. , Cunningham, K. , Ho, C.K. , Jiang, M. , Liu, G. , Liu, J. , Ma, L.-C. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Parish, D. , Rost, B. , Sukumaran, D. , Swapna, G.V. , Szyperski, T. , Xiao, R. , Xu, D.
Primary Citation of Related Structures: 2HG7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phage-like element PBSX protein xkdW | A | 110 | Bacillus Subtilis | MILYDAIMYKYPNAVSRKDFELRNDGNGSYIEKWNLRAPLPTQAELETWWEELQKNPPYEPPDQVELLAQELSQEKLARKQLEELNKTLGNELSDIKLSLLSLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2006-06-26 Deposition Author(s): Acton, T.B. , Atreya, H. , Baran, M. , Cunningham, K. , Ho, C.K. , Jiang, M. , Liu, G. , Liu, J. , Ma, L.-C. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Parish, D. , Rost, B. , Sukumaran, D. , Swapna, G.V. , Szyperski, T. , Xiao, R. , Xu, D.