Crystal structure of mouse putative dual specificity phosphatase complexed with zinc tungstate, new york structural genomics consortium
PDB DOI: 10.2210/pdb2hcm/pdb
Classification: HYDROLASE Organism(s): Mus Musculus
Deposited: 2006-06-17 Deposition Author(s): Almo, S.C. , Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Patskovsky, Y.
Crystal structure of mouse putative dual specificity phosphatase complexed with zinc tungstate, new york structural genomics consortium
Almo, S.C. , Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Patskovsky, Y.
Primary Citation of Related Structures: 2HCM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dual specificity protein phosphatase | A | 164 | Mus Musculus | SLGTSEAAPPPFARVAPALFIGNARAAGATELLVRAGITLCVNVSRQQPGPRAPGVAELRVPVFDDPAEDLLTHLEPTCAAMEAAVRDGGSCLVYCKNGRSRSAAVCTAYLMRHRGHSLDRAFQMVKSARPVAEPNLGFWAQLQKYEQTLQAQAILPREPIDPE |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-17 Deposition Author(s): Almo, S.C. , Burley, S.K. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Patskovsky, Y.