Crystal structure of the n-terminal domain of ribosomal protein l9 (ntl9)
PDB DOI: 10.2210/pdb2hbb/pdb
Classification: RNA BINDING PROTEIN Organism(s): Geobacillus Stearothermophilus
Deposited: 2006-06-14 Deposition Author(s): Cho, J.-H. , Kim, E.Y. , Raleigh, D.P. , Schindelin, H.
Crystal structure of the n-terminal domain of ribosomal protein l9 (ntl9)
Cho, J.-H. , Kim, E.Y. , Raleigh, D.P. , Schindelin, H.
Primary Citation of Related Structures: 2HBB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
50S ribosomal protein L9 | A | 51 | Geobacillus Stearothermophilus | MKVIFLKDVKGKGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQK |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-14 Deposition Author(s): Cho, J.-H. , Kim, E.Y. , Raleigh, D.P. , Schindelin, H.