2H5K
Crystal structure of complex between the domain-swapped dimeric grb2 sh2 domain and shc-derived ligand, ac-nh-ptyr-val-asn-nh2
PDB DOI: 10.2210/pdb2h5k/pdb
Classification: HORMONE/GROWTH FACTOR Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-05-26 Deposition Author(s): Benfield, A.P. , Martin, S.F. , Whiddon, B.B.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 3.25 Å
Crystal structure of complex between the domain-swapped dimeric grb2 sh2 domain and shc-derived ligand, ac-nh-ptyr-val-asn-nh2
Benfield, A.P. , Martin, S.F. , Whiddon, B.B.
Primary Citation of Related Structures: 2H5K
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Growth factor receptor-bound protein 2 | A | 116 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQHHHHHH |
| Growth factor receptor-bound protein 2 | B | 116 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQHHHHHH |
| Shc-Derived Ligand | C | 5 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XYVNX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2006-05-26 Deposition Author(s): Benfield, A.P. , Martin, S.F. , Whiddon, B.B.