Solution structure of the n-terminal domain of commd1 (murr1)
PDB DOI: 10.2210/pdb2h2m/pdb
Classification: METAL TRANSPORT Organism(s): Homo Sapiens
Deposited: 2006-05-19 Deposition Author(s): Rosenzweig, A.C. , Sommerhalter, M. , Zhang, Y.
Solution structure of the n-terminal domain of commd1 (murr1)
Rosenzweig, A.C. , Sommerhalter, M. , Zhang, Y.
Primary Citation of Related Structures: 2H2M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| COMM domain-containing protein 1 | A | 108 | Homo Sapiens | MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFNQLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRES |
Method: SOLUTION NMR
Deposited Date: 2006-05-19 Deposition Author(s): Rosenzweig, A.C. , Sommerhalter, M. , Zhang, Y.