Solution conformation of salmon calcitonin in sodium dodecyl sulfate micelles
PDB DOI: 10.2210/pdb2glh/pdb
Classification: HORMONE/GROWTH FACTOR Organism(s): N.A.
Deposited: 2006-04-04 Deposition Author(s): Amodeo, P. , Andreotti, G. , Lopez-Mendez, B. , Morelli, M.A. , Motta, A. , Nakamuta, H.
Solution conformation of salmon calcitonin in sodium dodecyl sulfate micelles
Amodeo, P. , Andreotti, G. , Lopez-Mendez, B. , Morelli, M.A. , Motta, A. , Nakamuta, H.
Primary Citation of Related Structures: 2GLH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Calcitonin-1 | A | 33 | N.A. | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTPX |
Method: SOLUTION NMR
Deposited Date: 2006-04-04 Deposition Author(s): Amodeo, P. , Andreotti, G. , Lopez-Mendez, B. , Morelli, M.A. , Motta, A. , Nakamuta, H.