The p52g mutant of amicyanin in the cu(ii) state.
PDB DOI: 10.2210/pdb2gb2/pdb
Classification: ELECTRON TRANSPORT Organism(s): Paracoccus Denitrificans
Deposited: 2006-03-09 Deposition Author(s): Carrell, C.J. , Davidson, V.L. , Ma, J.K. , Mathews, F.S.
The p52g mutant of amicyanin in the cu(ii) state.
Carrell, C.J. , Davidson, V.L. , Ma, J.K. , Mathews, F.S.
Primary Citation of Related Structures: 2GB2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Amicyanin | A | 105 | Paracoccus Denitrificans | DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMGHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-03-09 Deposition Author(s): Carrell, C.J. , Davidson, V.L. , Ma, J.K. , Mathews, F.S.