The 1.95 a crystal structure of vibrio cholerae extracellular endonuclease i
PDB DOI: 10.2210/pdb2g7f/pdb
Classification: HYDROLASE Organism(s): Vibrio Cholerae
Deposited: 2006-02-28 Deposition Author(s): Altermark, B. , Helland, R. , Smalaas, A.O. , Willassen, N.P.
The 1.95 a crystal structure of vibrio cholerae extracellular endonuclease i
Altermark, B. , Helland, R. , Smalaas, A.O. , Willassen, N.P.
Primary Citation of Related Structures: 2G7F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Endonuclease I | A | 211 | Vibrio Cholerae | APISFSHAKNEAVKIYRDHPVSFYCGCEIRWQGKKGIPDLESCGYQVRKNENRASRIEWEHVVPAWQFGHQLQCWQQGGRKNCTRTSPEFNQMEADLHNLTPAIGEVNGNRSNFSFSQWNGIDGVTYGQCEMQVNFKERTAMPPERARGAIARTYLYMSEQYGLRLSKAQNQLMQAWNNQYPVSEWECVRDQKIEKVQGNSNRFVREQCPN |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-02-28 Deposition Author(s): Altermark, B. , Helland, R. , Smalaas, A.O. , Willassen, N.P.