Crystal structure of ing2 phd finger in complex with h3k4me3 peptide
PDB DOI: 10.2210/pdb2g6q/pdb
Classification: GENE REGULATION, APOPTOSIS Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-02-24 Deposition Author(s): Kutateladze, T.G. , Pena, P.V. , Zhao, R.
Crystal structure of ing2 phd finger in complex with h3k4me3 peptide
Kutateladze, T.G. , Pena, P.V. , Zhao, R.
Primary Citation of Related Structures: 2G6Q
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Inhibitor of growth protein 2 | A | 62 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNE |
H3K4Me3 peptide | B | 12 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSTG |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-02-24 Deposition Author(s): Kutateladze, T.G. , Pena, P.V. , Zhao, R.