Crystal structure of ing2 phd finger in complex with h3k4me3 peptide
PDB DOI: 10.2210/pdb2g6q/pdb
Classification: GENE REGULATION, APOPTOSIS Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2006-02-24 Deposition Author(s): Kutateladze, T.G. , Pena, P.V. , Zhao, R.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Crystal structure of ing2 phd finger in complex with h3k4me3 peptide
Kutateladze, T.G. , Pena, P.V. , Zhao, R.
Primary Citation of Related Structures: 2G6Q
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Inhibitor of growth protein 2 | A | 62 | Mus Musculus , Synthetic Construct | GSEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNE |
| H3K4Me3 peptide | B | 12 | Mus Musculus , Synthetic Construct | ARTKQTARKSTG |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-02-24 Deposition Author(s): Kutateladze, T.G. , Pena, P.V. , Zhao, R.