2FUU
Nmr solution structure of the phd domain from the human bptf in complex with h3(1-15)k4me3 peptide
PDB DOI: 10.2210/pdb2fuu/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2006-01-27 Deposition Author(s): Ilin, S. , Patel, D.J.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of the phd domain from the human bptf in complex with h3(1-15)k4me3 peptide
Primary Citation of Related Structures: 2FUU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| bromodomain PHD finger transcription factor | A | 62 | Homo Sapiens , Synthetic Construct | GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA |
| Histone H3 | B | 15 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKA |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2006-01-27 Deposition Author(s): Ilin, S. , Patel, D.J.