2FUU
Nmr solution structure of the phd domain from the human bptf in complex with h3(1-15)k4me3 peptide
PDB DOI: 10.2210/pdb2fuu/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-01-27 Deposition Author(s): Ilin, S. , Patel, D.J.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of the phd domain from the human bptf in complex with h3(1-15)k4me3 peptide
Primary Citation of Related Structures: 2FUU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| bromodomain PHD finger transcription factor | A | 62 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA |
| Histone H3 | B | 15 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSTGGKA |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2006-01-27 Deposition Author(s): Ilin, S. , Patel, D.J.