The crystal structure of the n-terminal domain of hausp/usp7 complexed with mdm2 peptide 147-150
PDB DOI: 10.2210/pdb2fop/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2006-01-13 Deposition Author(s): Arrowsmith, C.H. , Duan, S. , Frappier, L. , Saridakis, V. , Sarkari, F. , Sheng, Y. , Wu, T.
The crystal structure of the n-terminal domain of hausp/usp7 complexed with mdm2 peptide 147-150
Arrowsmith, C.H. , Duan, S. , Frappier, L. , Saridakis, V. , Sarkari, F. , Sheng, Y. , Wu, T.
Primary Citation of Related Structures: 2FOP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin carboxyl-terminal hydrolase 7 | A | 155 | Homo Sapiens , Synthetic Construct | GSHTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW |
| mdm2 peptide | B | 6 | Homo Sapiens , Synthetic Construct | EKPSSS |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-01-13 Deposition Author(s): Arrowsmith, C.H. , Duan, S. , Frappier, L. , Saridakis, V. , Sarkari, F. , Sheng, Y. , Wu, T.