Evolution of enzymatic activity in the tautomerase superfamily: mechanistic and structural consequences of the l8r mutation in 4-oxalocrotonate tautomerase
PDB DOI: 10.2210/pdb2fm7/pdb
Classification: TRANSFERASE Organism(s): Bacillus Sp. (Strain Hil-Y85/54728)
Deposited: 2006-01-08 Deposition Author(s): Almrud, J.J. , Hackert, M.L.
Evolution of enzymatic activity in the tautomerase superfamily: mechanistic and structural consequences of the l8r mutation in 4-oxalocrotonate tautomerase
Primary Citation of Related Structures: 2FM7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
4-Oxalocrotonate Tautomerase | A | 62 | Bacillus Sp. (Strain Hil-Y85/54728) | PIAQIHIREGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASKVRG |
4-Oxalocrotonate Tautomerase | B | 62 | Bacillus Sp. (Strain Hil-Y85/54728) | PIAQIHIREGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASKVRG |
4-Oxalocrotonate Tautomerase | C | 62 | Bacillus Sp. (Strain Hil-Y85/54728) | PIAQIHIREGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASKVRG |
4-Oxalocrotonate Tautomerase | D | 62 | Bacillus Sp. (Strain Hil-Y85/54728) | PIAQIHIREGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASKVRG |
4-Oxalocrotonate Tautomerase | E | 62 | Bacillus Sp. (Strain Hil-Y85/54728) | PIAQIHIREGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASKVRG |
4-Oxalocrotonate Tautomerase | F | 62 | Bacillus Sp. (Strain Hil-Y85/54728) | PIAQIHIREGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASKVRG |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-01-08 Deposition Author(s): Almrud, J.J. , Hackert, M.L.