Nmr ensemble of the yeast saccharomyces cerevisiae protein ymr074cp core region
PDB DOI: 10.2210/pdb2fh0/pdb
Classification: UNKNOWN FUNCTION Organism(s): Saccharomyces Cerevisiae
Deposited: 2005-12-23 Deposition Author(s): Hong, J.J. , Shi, Y.Y. , Wu, J.H. , Zhang, J.H.
Method: SOLUTION NMR Resolution: N.A.
Nmr ensemble of the yeast saccharomyces cerevisiae protein ymr074cp core region
Hong, J.J. , Shi, Y.Y. , Wu, J.H. , Zhang, J.H.
Primary Citation of Related Structures: 2FH0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hypothetical 16.0 kDa protein in ABF2-CHL12 intergenic region | A | 81 | Saccharomyces Cerevisiae | GENSAPVGAAIANFLEPQALERLSRVALVRRDRAQAVETYLKKLIATNNVTHKITEAEIVSILNGIAKQQNSQNNSKIIFE |
Method: SOLUTION NMR
Deposited Date: 2005-12-23 Deposition Author(s): Hong, J.J. , Shi, Y.Y. , Wu, J.H. , Zhang, J.H.