2ES2
Crystal structure analysis of the bacillus subtilis cold shock protein bs-cspb in complex with hexathymidine
PDB DOI: 10.2210/pdb2es2/pdb
Classification: GENE REGULATION Organism(s): Bacillus Subtilis , Synthetic Construct
Deposited: 2005-10-25 Deposition Author(s): Bienert, M. , Heinemann, U. , Max, K.E.A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.78 Å
Crystal structure analysis of the bacillus subtilis cold shock protein bs-cspb in complex with hexathymidine
Bienert, M. , Heinemann, U. , Max, K.E.A.
Primary Citation of Related Structures: 2ES2
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5'-D(*TP*TP*TP*TP*TP*T)-3' | b | 6 | NA | TTTTTT |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cold shock protein cspB | A | 67 | Bacillus Subtilis , Synthetic Construct | MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2005-10-25 Deposition Author(s): Bienert, M. , Heinemann, U. , Max, K.E.A.