2EQE
Solution structure of the fourth a20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3
PDB DOI: 10.2210/pdb2eqe/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2007-03-30 Deposition Author(s): Hayahsi, F. , Nagasima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the fourth a20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3
Hayahsi, F. , Nagasima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.
Primary Citation of Related Structures: 2EQE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tumor necrosis factor, alpha-induced protein 3 | A | 48 | Homo Sapiens | GSSGSSGTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYSGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-03-30 Deposition Author(s): Hayahsi, F. , Nagasima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.