Solution structure of the 8th c2h2 type zinc finger domain of zinc finger protein 347
PDB DOI: 10.2210/pdb2eq0/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Homo Sapiens
Deposited: 2007-03-30 Deposition Author(s): Inoue, M. , Kigawa, T. , Masuda, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Terada, T. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the 8th c2h2 type zinc finger domain of zinc finger protein 347
Inoue, M. , Kigawa, T. , Masuda, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2EQ0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger protein 347 | A | 46 | Homo Sapiens | GSSGSSGTGEKPYKCHECGKVFRRNSHLARHQLIHTGEKPSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-03-30 Deposition Author(s): Inoue, M. , Kigawa, T. , Masuda, K. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Terada, T. , Yokoyama, S.