Solution structure of the 20th c2h2 type zinc finger domain of zinc finger protein 268
PDB DOI: 10.2210/pdb2epv/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2007-03-30 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Tanabe, W. , Terada, T. , Yokoyama, S.
Solution structure of the 20th c2h2 type zinc finger domain of zinc finger protein 268
Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Tanabe, W. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2EPV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| Zinc finger protein 268 | A | 44 | Homo Sapiens | GSSGSSGSGEKPYECNECGKAFIWKSLLIVHERTHAGVSGPSSG | 
Method: SOLUTION NMR
Deposited Date: 2007-03-30 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Tanabe, W. , Terada, T. , Yokoyama, S.