Solution structure of zinc finger domain 7 in zinc finger protein 32
PDB DOI: 10.2210/pdb2epc/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2007-03-29 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Solution structure of zinc finger domain 7 in zinc finger protein 32
Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Primary Citation of Related Structures: 2EPC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| Zinc finger protein 32 | A | 42 | Homo Sapiens | GSSGSSGGETPYLCGQCGKSFTQRGSLAVHQRSCSQSGPSSG | 
Method: SOLUTION NMR
Deposited Date: 2007-03-29 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.