Solution structure of the c2h2 type zinc finger (region 273-303) of human zinc finger protein 268
PDB DOI: 10.2210/pdb2emx/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2007-03-28 Deposition Author(s): Abe, H. , Kigawa, T. , Kobayashi, N. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Sato, M. , Tochio, N. , Tomizawa, T. , Yokoyama, S.
Solution structure of the c2h2 type zinc finger (region 273-303) of human zinc finger protein 268
Abe, H. , Kigawa, T. , Kobayashi, N. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Sato, M. , Tochio, N. , Tomizawa, T. , Yokoyama, S.
Primary Citation of Related Structures: 2EMX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger protein 268 | A | 44 | Homo Sapiens | GSSGSSGEKPFGCSCCEKAFSSKSYLLVHQQTHAEEKPSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-03-28 Deposition Author(s): Abe, H. , Kigawa, T. , Kobayashi, N. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Sato, M. , Tochio, N. , Tomizawa, T. , Yokoyama, S.