Crystal structure of flavin reductase hpac complexed with fad and nad
PDB DOI: 10.2210/pdb2ed4/pdb
Classification: OXIDOREDUCTASE Organism(s): Thermus Thermophilus
Deposited: 2007-02-14 Deposition Author(s): Ebihara, A. , Hisano, T. , Iwasaki, W. , Kim, S.H. , Miki, K.
Crystal structure of flavin reductase hpac complexed with fad and nad
Ebihara, A. , Hisano, T. , Iwasaki, W. , Kim, S.H. , Miki, K.
Primary Citation of Related Structures: 2ED4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| flavin reductase (HpaC) of 4-hydroxyphenylacetate 3-monooxygenae | A | 149 | Thermus Thermophilus | MKEAFKEALARFASGVTVVAARLGEEERGMTATAFMSLSLEPPLVALAVSERAKLLPVLEGAGAFTVSLLREGQEAVSEHFAGRPKEGIALEEGRVKGALAVLRCRLHALYPGGDHRIVVGLVEEVELGEGGPPLVYFQRGYRRLVWPS |
| flavin reductase (HpaC) of 4-hydroxyphenylacetate 3-monooxygenae | B | 149 | Thermus Thermophilus | MKEAFKEALARFASGVTVVAARLGEEERGMTATAFMSLSLEPPLVALAVSERAKLLPVLEGAGAFTVSLLREGQEAVSEHFAGRPKEGIALEEGRVKGALAVLRCRLHALYPGGDHRIVVGLVEEVELGEGGPPLVYFQRGYRRLVWPS |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-02-14 Deposition Author(s): Ebihara, A. , Hisano, T. , Iwasaki, W. , Kim, S.H. , Miki, K.