Solution structure of the sh3 domain of sorbin and sh3 domain-containing protein 1
PDB DOI: 10.2210/pdb2ecz/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-02-14 Deposition Author(s): Abe, H. , Kigawa, T. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Tochio, N. , Yokoyama, S.
Solution structure of the sh3 domain of sorbin and sh3 domain-containing protein 1
Abe, H. , Kigawa, T. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Tochio, N. , Yokoyama, S.
Primary Citation of Related Structures: 2ECZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sorbin and SH3 domain-containing protein 1 | A | 70 | Homo Sapiens | GSSGSSGGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVISGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-02-14 Deposition Author(s): Abe, H. , Kigawa, T. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Tochio, N. , Yokoyama, S.