Solution structure of the ring domain of the human ring finger protein 141
PDB DOI: 10.2210/pdb2ecn/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-02-13 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S.
Solution structure of the ring domain of the human ring finger protein 141
Harada, T. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2ECN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RING finger protein 141 | A | 70 | Homo Sapiens | GSSGSSGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-02-13 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Miyamoto, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S.