Solution structure of the second zf-ranbp domain from human nuclear pore complex protein nup153
PDB DOI: 10.2210/pdb2ebq/pdb
Classification: TRANSPORT PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-02-09 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M. , Zhang, H.P.
Solution structure of the second zf-ranbp domain from human nuclear pore complex protein nup153
Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M. , Zhang, H.P.
Primary Citation of Related Structures: 2EBQ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Nuclear pore complex protein Nup153 | A | 47 | Homo Sapiens | GSSGSSGVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLT |
Method: SOLUTION NMR
Deposited Date: 2007-02-09 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M. , Zhang, H.P.