Solution structure of the ig-like domain (714-804) from human obscurin-like protein 1
PDB DOI: 10.2210/pdb2e6p/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2006-12-28 Deposition Author(s): Hayashi, F. , Qin, X.R. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Suetake, T. , Yokoyama, S.
Solution structure of the ig-like domain (714-804) from human obscurin-like protein 1
Hayashi, F. , Qin, X.R. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Suetake, T. , Yokoyama, S.
Primary Citation of Related Structures: 2E6P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Obscurin-like protein 1 | A | 104 | Homo Sapiens | GSSGSSGPVHILSPQDKVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-12-28 Deposition Author(s): Hayashi, F. , Qin, X.R. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Suetake, T. , Yokoyama, S.