Crystal structure of the clip-170 cap-gly domain 1
PDB DOI: 10.2210/pdb2e3i/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2006-11-26 Deposition Author(s): Hakoshima, T. , Maesaki, R.
Crystal structure of the clip-170 cap-gly domain 1
Primary Citation of Related Structures: 2E3I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Restin | A | 86 | Homo Sapiens | DDFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRKVQAEDEANGLQTTP |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-11-26 Deposition Author(s): Hakoshima, T. , Maesaki, R.