Crystal structure of human estrogen-related receptor gamma ligand binding domain complex with bisphenol a
PDB DOI: 10.2210/pdb2e2r/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2006-11-16 Deposition Author(s): Kakuta, Y. , Kimura, M. , Koshiba, T. , Matsushima, A. , Shimohigashi, Y. , Teramoto, T.
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Crystal structure of human estrogen-related receptor gamma ligand binding domain complex with bisphenol a
Kakuta, Y. , Kimura, M. , Koshiba, T. , Matsushima, A. , Shimohigashi, Y. , Teramoto, T.
Primary Citation of Related Structures: 2E2R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Estrogen-related receptor gamma | A | 244 | Homo Sapiens | LGSPEFLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKVC |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-11-16 Deposition Author(s): Kakuta, Y. , Kimura, M. , Koshiba, T. , Matsushima, A. , Shimohigashi, Y. , Teramoto, T.