Solution structure of bmkalphait01, an alpha-insect toxin from the venom of the chinese scorpion buthus martensi karsch
PDB DOI: 10.2210/pdb2e0h/pdb
Classification: TOXIN Organism(s): Mesobuthus Martensii
Deposited: 2006-10-08 Deposition Author(s): Chen, X. , Tong, X.T. , Wu, H.M.
Solution structure of bmkalphait01, an alpha-insect toxin from the venom of the chinese scorpion buthus martensi karsch
Chen, X. , Tong, X.T. , Wu, H.M.
Primary Citation of Related Structures: 2E0H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Alpha-neurotoxin TX12 | A | 64 | Mesobuthus Martensii | VRDAYIAQNYNCVYHCARDAYCNELCTKNGAKSGSCPYLGEHKFACYCKDLPDNVPIRVPGKCH |
Method: SOLUTION NMR
Deposited Date: 2006-10-08 Deposition Author(s): Chen, X. , Tong, X.T. , Wu, H.M.