Structure of the ubx domain in mouse ubx domain-containing protein 2
PDB DOI: 10.2210/pdb2dzk/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Mus Musculus
Deposited: 2006-09-29 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S. , Yoneyama, M. , Zhao, C.
Structure of the ubx domain in mouse ubx domain-containing protein 2
Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S. , Yoneyama, M. , Zhao, C.
Primary Citation of Related Structures: 2DZK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| UBX domain-containing protein 2 | A | 109 | Mus Musculus | GSSGSSGRDRSTIARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNFSLATMFPRREFTREDYKRRLLDLELAPSASVVLLPAGRPATSIVHSSSGDILMID |
Method: SOLUTION NMR
Deposited Date: 2006-09-29 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Watanabe, S. , Yokoyama, S. , Yoneyama, M. , Zhao, C.