Nmr structure of mini-b, an n-terminal- c-terminal construct from human surfactant protein b (sp-b), in sodium dodecyl sulfate (sds) micelles
PDB DOI: 10.2210/pdb2dwf/pdb
Classification: SURFACE ACTIVE PROTEIN Organism(s): N.A.
Deposited: 2006-08-11 Deposition Author(s): Booth, V. , Keough, K.M.W. , Sarker, M. , Waring, A.J.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of mini-b, an n-terminal- c-terminal construct from human surfactant protein b (sp-b), in sodium dodecyl sulfate (sds) micelles
Booth, V. , Keough, K.M.W. , Sarker, M. , Waring, A.J.
Primary Citation of Related Structures: 2DWF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Pulmonary surfactant-associated protein B | A | 34 | N.A. | CWLCRALIKRIQAMIPKGGRMLPQLVCRLVLRCS |
Method: SOLUTION NMR
Deposited Date: 2006-08-11 Deposition Author(s): Booth, V. , Keough, K.M.W. , Sarker, M. , Waring, A.J.