Crystal structure of rubredoxin from desulfovibrio gigas to ultra-high 0.68 a resolution
PDB DOI: 10.2210/pdb2dsx/pdb
Classification: ELECTRON TRANSPORT Organism(s): Desulfovibrio Gigas
Deposited: 2006-07-07 Deposition Author(s): Chen, C.-J. , Huang, Y.-C. , Lin, Y.-H. , Liu, M.-Y.
Crystal structure of rubredoxin from desulfovibrio gigas to ultra-high 0.68 a resolution
Chen, C.-J. , Huang, Y.-C. , Lin, Y.-H. , Liu, M.-Y.
Primary Citation of Related Structures: 2DSX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Rubredoxin | A | 52 | Desulfovibrio Gigas | MDIYVCTVCGYEYDPAKGDPDSGIKPGTKFEDLPDDWACPVCGASKDAFEKQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-07-07 Deposition Author(s): Chen, C.-J. , Huang, Y.-C. , Lin, Y.-H. , Liu, M.-Y.